PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 327aa    MW: 36289 Da    PI: 8.9094
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0526genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g++R++k+c++rw +yl
      Gh_A01G0526 14 KGPWTAEEDQKLIDYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding41.82.5e-1368113247
                      SSS-HHHHH..HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEde..llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+++ eEde   +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_A01G0526  68 GKFSIEEDEvkVIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 113
                      666666665227***********.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26664IPR009057Homeodomain-like
PROSITE profilePS5129425.987965IPR017930Myb domain
SuperFamilySSF466897.11E-3011110IPR009057Homeodomain-like
SMARTSM007173.6E-161363IPR001005SANT/Myb domain
PfamPF002493.5E-171461IPR001005SANT/Myb domain
CDDcd001671.48E-131661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465118IPR009057Homeodomain-like
PROSITE profilePS5129419.24866118IPR017930Myb domain
SMARTSM007173.0E-1066116IPR001005SANT/Myb domain
PfamPF002495.9E-1268113IPR001005SANT/Myb domain
CDDcd001676.89E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGKPPGCDKN GLKKGPWTAE EDQKLIDYIQ KHGHGRWRTL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGKF SIEEDEVKVI IQLHSVLGNK WSAIAARLPG RTDNEIKNYW NTHIKKKLLR  120
MGIDPVTHAP RLDLLELSSL LSSSLYNSSL NPAGFVGSMF NPSFLSLATA FLSSNQTKNL  180
EINNLAGDIQ QIQNPYEPYQ GNQVPVITQV SQADLNQFSA NPGLPNLWQI DNNVSDSKGF  240
LPTTMQNING YNHGFNLGDQ NLQQVCTFSE KIPNLVPFGS LLSTPSSSST PLNNGSSTED  300
IERDSYCSSN NLLIFDVPKG LNVNGSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-31121182105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-31121182105C-Myb DNA-Binding Domain
1msf_C1e-31121182105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459089.10.0PREDICTED: myb-related protein 330-like
SwissprotQ8GWP09e-65MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2Q9C60.0A0A0D2Q9C6_G
STRINGVIT_19s0014g03820.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2234145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-84MYB-like 102